|
Abbreviated name: BNP
Synonyms: BNP(1-32) | BNP-32 | brain natriuretic peptide 32 | Natrecor®
brain natriuretic peptide is an approved drug (FDA (2001))
Compound class:
Endogenous peptide in human, mouse or rat
Comment: Nesiritide is the recombinant form of human brain natriuretic peptide.
Species: Human
View more information in the IUPHAR Pharmacology Education Project: brain natriuretic peptide |
Peptide Sequence  |
|
| SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH | |
| Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His | |
| Selected 3D Structures | ||
|
||
| Post-translational Modification | |
| Disulphide bond formation between cysteine residues at positions 1 and 112 | |
